Ver mas grande
Fgf21 (Mouse) Recombinant Protein
AB-P8632
Producto nuevo
Fgf21 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Fgf21 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 21 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYASLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) in 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 56636 |
Más información
Mouse Fgf21 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.