FGF20 (Human) Recombinant Protein
  • FGF20 (Human) Recombinant Protein

FGF20 (Human) Recombinant Protein

Ref: AB-P8627
FGF20 (Human) Recombinant Protein

Información del producto

Human FGF20 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 15 ug
Gene Name FGF20
Gene Alias -
Gene Description fibroblast growth factor 20
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MHHHHHHAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing MOPS, (NH4)2SO4, DTT, EDTA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 26281

Enviar un mensaje


FGF20 (Human) Recombinant Protein

FGF20 (Human) Recombinant Protein