Ver mas grande
FGF18 (Human) Recombinant Protein
AB-P8623
Producto nuevo
FGF18 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | FGF18 |
| Gene Alias | FGF-18|ZFGF5 |
| Gene Description | fibroblast growth factor 18 |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MKHHHHHHASEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 7.4, 5% w/v trehalos. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5 mg/mL, and is not sterile! Please filter the product by an sterile filter before use. |
| Gene ID | 8817 |
Más información
Human FGF18 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.