Ver mas grande
FGF17 (Human) Recombinant Protein
AB-P8618
Producto nuevo
FGF17 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | FGF17 |
| Gene Alias | FGF-13 |
| Gene Description | fibroblast growth factor 17 |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1mg/ml) in 20mM Tris-HCl buffer (pH 8.0) cantaining 10% glycerol, 0.4M urea. |
| Gene ID | 8822 |
Más información
Human FGF17 partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.