Ver mas grande
FGF12 (Human) Recombinant Protein
AB-P8611
Producto nuevo
FGF12 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | FGF12 |
| Gene Alias | FGF12B|FHF1 |
| Gene Description | fibroblast growth factor 12 |
| Storage Conditions | Stored at 4ºC for 7 days, should be stored at -20ºC. |
| Immunogen Prot. Seq | MSSHHHHHHSSGLVPRGSHMESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRRKSSGTPTMNGGKVVNQDST |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1mg/ml) in 20mM Tris buffer (pH 7.5) containing 10% glycerol, 1mM DTT, 2mM EDTA. |
| Gene ID | 2257 |
Más información
Human FGF12 partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.