Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
FGF12 (Human) Recombinant Protein
Abnova
FGF12 (Human) Recombinant Protein
Ref: AB-P8611
FGF12 (Human) Recombinant Protein
Contáctenos
Información del producto
Human FGF12 partial recombinant protein with His tag at N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
FGF12
Gene Alias
FGF12B|FHF1
Gene Description
fibroblast growth factor 12
Storage Conditions
Stored at 4C for 7 days, should be stored at -20C.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MSSHHHHHHSSGLVPRGSHMESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRRKSSGTPTMNGGKVVNQDST
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution (1mg/ml) in 20mM Tris buffer (pH 7.5) containing 10% glycerol, 1mM DTT, 2mM EDTA.
Gene ID
2257
Enviar un mensaje
FGF12 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*