EPOR (Human) Recombinant Protein Ver mas grande

EPOR (Human) Recombinant Protein

AB-P8579

Producto nuevo

EPOR (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name EPOR
Gene Alias MGC138358
Gene Description erythropoietin receptor
Storage Conditions Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer In? PBS, pH 7.4 (10% glycerol).
Gene ID 2057

Más información

Human EPOR partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.

Consulta sobre un producto

EPOR (Human) Recombinant Protein

EPOR (Human) Recombinant Protein