EPOR (Human) Recombinant Protein
  • EPOR (Human) Recombinant Protein

EPOR (Human) Recombinant Protein

Ref: AB-P8579
EPOR (Human) Recombinant Protein

Información del producto

Human EPOR partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
Información adicional
Size 2 x 10 ug
Gene Name EPOR
Gene Alias MGC138358
Gene Description erythropoietin receptor
Storage Conditions Stored at 4C for 2-4 weeks, should be stored at -20C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer In? PBS, pH 7.4 (10% glycerol).
Gene ID 2057

Enviar un mensaje


EPOR (Human) Recombinant Protein

EPOR (Human) Recombinant Protein