Ver mas grande
Epo (Rat) Recombinant Protein
AB-P8577
Producto nuevo
Epo (Rat) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Epo |
| Gene Alias | - |
| Gene Description | erythropoietin |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | DGSAPPRLICDSRVLERYILEAKEAENVTMGCAEGPRLSENITVPDTKVNFYAWKRMKVEEQAVEVWQGLSLLSEAILQAQALQANSSQPPESLQLHIDKAISGLRSLTSLLRVLGAQKELMSPPDATQAAPLRTLTADTFCKLFRVYSNFLRGKLKLYTGEACRRGDRHHHHHH |
| Form | Liquid |
| Antigen species Target species | Rat |
| Storage Buffer | In? PBS, pH 7.4 (10% glycerol). |
| Gene ID | 24335 |
Más información
Rat Epo partial recombinant protein with His tag in C-terminus expressed in?HEK293 cells.