EPO (Human) Recombinant Protein
  • EPO (Human) Recombinant Protein

EPO (Human) Recombinant Protein

Ref: AB-P8575
EPO (Human) Recombinant Protein

Información del producto

Human EPO partial recombinant protein with His tag in C-terminus expressed in Sf9 cells.
Información adicional
Size 2 x 10 ug
Gene Name EPO
Gene Alias EP|MGC138142
Gene Description erythropoietin
Storage Conditions Stored at 4C for 2-4 weeks, should be stored at -20C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALRAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDRLEHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer In? PBS, pH 7.4 (10% glycerol).
Gene ID 2056

Enviar un mensaje


EPO (Human) Recombinant Protein

EPO (Human) Recombinant Protein