EPO (Human) Recombinant Protein
  • EPO (Human) Recombinant Protein

EPO (Human) Recombinant Protein

Ref: AB-P8571
EPO (Human) Recombinant Protein

Información del producto

Human EPO recombinant protein expressed in?CHO cells.
Información adicional
Size 50 ug
Gene Name EPO
Gene Alias EP|MGC138142
Gene Description erythropoietin
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Form Lyophilized
Antigen species Target species Human
Storage Buffer Each mg of lyophilized powder contains 0.59 mg sodium citrate, 0.58 mg sodium chloride and 0.006 mg citric acid. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 2056

Enviar un mensaje


EPO (Human) Recombinant Protein

EPO (Human) Recombinant Protein