EREG (Human) Recombinant Protein
  • EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein

Ref: AB-P8569
EREG (Human) Recombinant Protein

Información del producto

Human EREG (O14944, 63 a.a.- 108 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name EREG
Gene Alias ER
Gene Description epiregulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL.
Form Liquid
Antigen species Target species Human
Storage Buffer EREG protein solution (0.5mg/ml) containing 20mM Tris-HCl buffer (pH8.0) and 10% glycerol.
Gene ID 2069

Enviar un mensaje


EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein