SCYE1 (Human) Recombinant Protein
  • SCYE1 (Human) Recombinant Protein

SCYE1 (Human) Recombinant Protein

Ref: AB-P8558
SCYE1 (Human) Recombinant Protein

Información del producto

Human SCYE1 (Q12904) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name SCYE1
Gene Alias AIMP1|EMAP2|EMAPII|p43
Gene Description small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM sodium Phosphate buffer (pH 7.5) and 130mM sodium chloride.
Gene ID 9255

Enviar un mensaje


SCYE1 (Human) Recombinant Protein

SCYE1 (Human) Recombinant Protein