Egf (Mouse) Recombinant Protein
  • Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein

Ref: AB-P8553
Egf (Mouse) Recombinant Protein

Información del producto

Mouse Egf (P01132, 977 a.a. - 1029 a.a.) partial-length recombinant protein with N-terminal His-tag expressed in Escherichia coli.
Información adicional
Size 5 ug
Gene Name Egf
Gene Alias AI790464
Gene Description epidermal growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR.
Form Liquid
Antigen species Target species Mouse
Storage Buffer EGF protein solution (0.25mg/ml) contains 10% glycerol, 20mM Tris-HCl (pH 8.0), 0.1M NaCl & 2mM DTT.
Gene ID 13645

Enviar un mensaje


Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein