Egf (Mouse) Recombinant Protein
  • Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein

Ref: AB-P8551
Egf (Mouse) Recombinant Protein

Información del producto

Mouse Egf (P01132) recombinant protein with N-terminal biotin expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Egf
Gene Alias AI790464
Gene Description epidermal growth factor
Storage Conditions Should be stored at 4C.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MKKIDDDKNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLEWWELR.
Form Liquid
Antigen species Target species Mouse
Storage Buffer The protein (0.5mg/ml) solution contains sterile PBS.
Gene ID 13645

Enviar un mensaje


Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein