Egf (Mouse) Recombinant Protein
  • Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein

Ref: AB-P8549
Egf (Mouse) Recombinant Protein

Información del producto

Mouse Egf (P01132) recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Egf
Gene Alias AI790464
Gene Description epidermal growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer The protein was lyophilized with no additives.
Gene ID 13645

Enviar un mensaje


Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein