Egf (Mouse) Recombinant Protein Ver mas grande

Egf (Mouse) Recombinant Protein

AB-P8549

Producto nuevo

Egf (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.


Hoja técnica

Size 100 ug
Gene Name Egf
Gene Alias AI790464
Gene Description epidermal growth factor
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer The protein was lyophilized with no additives.
Gene ID 13645

Más información

Mouse Egf (P01132) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Egf (Mouse) Recombinant Protein

Egf (Mouse) Recombinant Protein