Ebi3 (Mouse) Recombinant Protein
  • Ebi3 (Mouse) Recombinant Protein

Ebi3 (Mouse) Recombinant Protein

Ref: AB-P8540
Ebi3 (Mouse) Recombinant Protein

Información del producto

Mouse Ebi3 (O35228) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Ebi3
Gene Alias EBI-3|IL-27
Gene Description Epstein-Barr virus induced gene 3
Storage Conditions Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution EBI3 should be stored at 4C between 2-7 days and for future use below -18C.
Application Key SDS-PAGE
Immunogen Prot. Seq MALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKP.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from 10mM Sodium Citrate pH-3.
Gene ID 50498

Enviar un mensaje


Ebi3 (Mouse) Recombinant Protein

Ebi3 (Mouse) Recombinant Protein