CYTL1 (Human) Recombinant Protein
  • CYTL1 (Human) Recombinant Protein

CYTL1 (Human) Recombinant Protein

Ref: AB-P8535
CYTL1 (Human) Recombinant Protein

Información del producto

Human CYTL1 (Q9NRR1, 23 a.a.- 136 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CYTL1
Gene Alias C17|C4orf4
Gene Description cytokine-like 1
Storage Conditions Store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time
it does not show any change after two weeks at 4C.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer CYTL1 was filtered (0.4 um) and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl, pH 7.5.
Gene ID 54360

Enviar un mensaje


CYTL1 (Human) Recombinant Protein

CYTL1 (Human) Recombinant Protein