Ver mas grande
CYTL1 (Human) Recombinant Protein
AB-P8535
Producto nuevo
CYTL1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CYTL1 |
| Gene Alias | C17|C4orf4 |
| Gene Description | cytokine-like 1 |
| Storage Conditions | Store lyophilized protein at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4ºC for a limited period of time |
| Immunogen Prot. Seq | MKHHHHHHASTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | CYTL1 was filtered (0.4 um) and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl, pH 7.5. |
| Gene ID | 54360 |
Más información
Human CYTL1 (Q9NRR1, 23 a.a.- 136 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.