CTLA4 (Human) Recombinant Protein
  • CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein

Ref: AB-P8531
CTLA4 (Human) Recombinant Protein

Información del producto

Human CTLA4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time.
Application Key SDS-PAGE
Immunogen Prot. Seq ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
Form Liquid
Antigen species Target species Human
Storage Buffer CTLA4 protein solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 1493

Enviar un mensaje


CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein