Ver mas grande
CTLA4 (Human) Recombinant Protein
AB-P8530
Producto nuevo
CTLA4 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | CTLA4 |
| Gene Alias | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
| Gene Description | cytotoxic T-lymphocyte-associated protein 4 |
| Storage Conditions | Store at 4ºC if entire vial will be used within 2-4 weeks. Store, frozen at -20ºC for longer periods of time. |
| Immunogen Prot. Seq | ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | CTLA4 protein solution (0.25 mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 20% glycerol. |
| Gene ID | 1493 |
Más información
Human CTLA4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.