CCN2 (Human) Recombinant Protein
  • CCN2 (Human) Recombinant Protein

CCN2 (Human) Recombinant Protein

Ref: AB-P8523
CCN2 (Human) Recombinant Protein

Información del producto

Human CCN2 (P29279) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CTGF
Gene Alias CCN2|HCS24|IGFBP8|MGC102839|NOV2
Gene Description connective tissue growth factor
Storage Conditions Lyophilized CTGF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CTGF should be stored at 4C between 2-7 days and for future use below -18C.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA.
Form Lyophilized
Antigen species Target species Human
Storage Buffer CTGF was Lyophilized from a sterile filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 1490

Enviar un mensaje


CCN2 (Human) Recombinant Protein

CCN2 (Human) Recombinant Protein