Ctf1 (Mouse) Recombinant Protein
  • Ctf1 (Mouse) Recombinant Protein

Ctf1 (Mouse) Recombinant Protein

Ref: AB-P8520
2 x 10 ug

Información del producto

Ctf1 (Mouse) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name Ctf1
Gene Alias CT-1
Gene Description cardiotrophin 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Gene ID 13019

Enviar un mensaje


Ctf1 (Mouse) Recombinant Protein

Ctf1 (Mouse) Recombinant Protein