Ctf1 (Mouse) Recombinant Protein Ver mas grande

Ctf1 (Mouse) Recombinant Protein

AB-P8520

Producto nuevo

Ctf1 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name Ctf1
Gene Alias CT-1
Gene Description cardiotrophin 1
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Gene ID 13019

Más información

Mouse Ctf1 (Q60753) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Ctf1 (Mouse) Recombinant Protein

Ctf1 (Mouse) Recombinant Protein