Clcf1 (Rat) Recombinant Protein
  • Clcf1 (Rat) Recombinant Protein

Clcf1 (Rat) Recombinant Protein

Ref: AB-P8510
25 ug

Información del producto

Clcf1 (Rat) Recombinant Protein
Información adicional
Size 25 ug
Gene Name Clcf1
Gene Alias Bsf3|Clc|MGC112574|NNT-1
Gene Description cardiotrophin-like cytokine factor 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from a concentrated (1mg/mL) solution in water containing 0.025% NaHCO3.
Gene ID 365395

Enviar un mensaje


Clcf1 (Rat) Recombinant Protein

Clcf1 (Rat) Recombinant Protein