Ver mas grande
Clcf1 (Rat) Recombinant Protein
AB-P8510
Producto nuevo
Clcf1 (Rat) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Clcf1 |
| Gene Alias | Bsf3|Clc|MGC112574|NNT-1 |
| Gene Description | cardiotrophin-like cytokine factor 1 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM. |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from a concentrated (1mg/mL) solution in water containing 0.025% NaHCO3. |
| Gene ID | 365395 |
Más información
Rat Clcf1 (P20294) recombinant protein expressed in Escherichia coli.