Armetl1 (Mouse) Recombinant Protein Ver mas grande

Armetl1 (Mouse) Recombinant Protein

AB-P8503

Producto nuevo

Armetl1 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Armetl1
Gene Alias 9330140G23|CDNF|MGC129430
Gene Description arginine-rich, mutated in early stage tumors-like 1
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer CDNF protein was lyophilized from a 0.2um filtered concentrated solution in 1xPBS, pH 7.4.
Gene ID 227526

Más información

Mouse Armetl1 (Q8CC36) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Armetl1 (Mouse) Recombinant Protein

Armetl1 (Mouse) Recombinant Protein