Btc (Mouse) Recombinant Protein
  • Btc (Mouse) Recombinant Protein

Btc (Mouse) Recombinant Protein

Ref: AB-P8500
Btc (Mouse) Recombinant Protein

Información del producto

Mouse Btc (Q05928) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Btc
Gene Alias -
Gene Description betacellulin, epidermal growth factor family member
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a 0.2um filtered concentrated solution in 1 PBS, pH 7.4.
Gene ID 12223

Enviar un mensaje


Btc (Mouse) Recombinant Protein

Btc (Mouse) Recombinant Protein