BTC (Human) Recombinant Protein
  • BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein

Ref: AB-P8498
BTC (Human) Recombinant Protein

Información del producto

Human BTC (P35070, 32 a.a. - 111 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name BTC
Gene Alias -
Gene Description betacellulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY.
Form Liquid
Antigen species Target species Human
Storage Buffer The BTC solution (0.25mg/mL) contains 20mM Tris-HCl buffer (pH 8.0), 5mM DTT, 0.2M NaCl and 20% glycerol.
Gene ID 685

Enviar un mensaje


BTC (Human) Recombinant Protein

BTC (Human) Recombinant Protein