Ver mas grande
NPPB (Human) Recombinant Protein
AB-P8492
Producto nuevo
NPPB (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | NPPB |
| Gene Alias | BNP |
| Gene Description | natriuretic peptide precursor B |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MKHHHHHHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | BNP filtered (0.4 um) and lyophilized from 0.5mg/mL in 20 mM Tris buffer and 50 mM NaCl, pH 7.5. |
| Gene ID | 4879 |
Más información
Human NPPB (P16860, 27 a.a. - 102 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.