NPPB (Human) Recombinant Protein
  • NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein

Ref: AB-P8490
NPPB (Human) Recombinant Protein

Información del producto

Human NPPB (P16860, 27 a.a. - 134 a.a) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name NPPB
Gene Alias BNP
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Form Liquid
Antigen species Target species Human
Storage Buffer BNP 1mg/mL is formulated with 1X PBS pH-7.4, 2mM DTT, 0.1mM PMSF, 1mM EDTA and 40% glycerol.
Gene ID 4879

Enviar un mensaje


NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein