NPPB (Human) Recombinant Protein
  • NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein

Ref: AB-P8489
NPPB (Human) Recombinant Protein

Información del producto

Human NPPB (P16860) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name NPPB
Gene Alias BNP
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Natriuretic Peptide Precursor B was lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Gene ID 4879

Enviar un mensaje


NPPB (Human) Recombinant Protein

NPPB (Human) Recombinant Protein