Ver mas grande
GDF6 (Human) Recombinant Protein
AB-P8482
Producto nuevo
GDF6 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | GDF6 |
| Gene Alias | BMP13|CDMP2|KFS|KFSL|MGC158100|MGC158101|SGM1 |
| Gene Description | growth differentiation factor 6 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | BMP-13 protein was lyophilized from a 0.2um filtered concentrated solution in 30% Acetonitrile and 0.1% TFA. |
| Gene ID | 392255 |
Más información
Human GDF6 (Q6KF10) recombinant protein expressed in Escherichia coli.