GDF6 (Human) Recombinant Protein
  • GDF6 (Human) Recombinant Protein

GDF6 (Human) Recombinant Protein

Ref: AB-P8482
50 ug

Información del producto

GDF6 (Human) Recombinant Protein
Información adicional
Size 50 ug
Gene Name GDF6
Gene Alias BMP13|CDMP2|KFS|KFSL|MGC158100|MGC158101|SGM1
Gene Description growth differentiation factor 6
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer BMP-13 protein was lyophilized from a 0.2um filtered concentrated solution in 30% Acetonitrile and 0.1% TFA.
Gene ID 392255

Enviar un mensaje


GDF6 (Human) Recombinant Protein

GDF6 (Human) Recombinant Protein