BMP3 (Human) Recombinant Protein
  • BMP3 (Human) Recombinant Protein

BMP3 (Human) Recombinant Protein

Ref: AB-P8472
BMP3 (Human) Recombinant Protein

Información del producto

Human BMP3 (P12645) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name BMP3
Gene Alias BMP-3A
Gene Description bone morphogenetic protein 3
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer BMP-3 protein was lyophilized from a 0.2um filtered concentrated solution in 30% Acetonitrile and 0.1% TFA.
Gene ID 651

Enviar un mensaje


BMP3 (Human) Recombinant Protein

BMP3 (Human) Recombinant Protein