Defb14 (Mouse) Recombinant Protein
  • Defb14 (Mouse) Recombinant Protein

Defb14 (Mouse) Recombinant Protein

Ref: AB-P8456
20 ug

Información del producto

Defb14 (Mouse) Recombinant Protein
Información adicional
Size 20 ug
Gene Name Defb14
Gene Alias mBD14
Gene Description defensin beta 14
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 244332

Enviar un mensaje


Defb14 (Mouse) Recombinant Protein

Defb14 (Mouse) Recombinant Protein