Ver mas grande
DEFB104A (Human) Recombinant Protein
AB-P8453
Producto nuevo
DEFB104A (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | DEFB104A |
| Gene Alias | BD-4|DEFB-4|DEFB104|DEFB4|MGC118942|MGC118944|MGC118945|hBD-4 |
| Gene Description | defensin, beta 104A |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20mM sodium Phosphate buffer pH 7.4 and 130mM NaCl. |
| Gene ID | 140596 |
Más información
Human DEFB104A (Q8WTQ1) recombinant protein expressed in Escherichia coli.