DEFB104A (Human) Recombinant Protein
  • DEFB104A (Human) Recombinant Protein

DEFB104A (Human) Recombinant Protein

Ref: AB-P8453
20 ug

Información del producto

DEFB104A (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name DEFB104A
Gene Alias BD-4|DEFB-4|DEFB104|DEFB4|MGC118942|MGC118944|MGC118945|hBD-4
Gene Description defensin, beta 104A
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM sodium Phosphate buffer pH 7.4 and 130mM NaCl.
Gene ID 140596

Enviar un mensaje


DEFB104A (Human) Recombinant Protein

DEFB104A (Human) Recombinant Protein