Ver mas grande
Defb3 (Rat) Recombinant Protein
AB-P8452
Producto nuevo
Defb3 (Rat) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Defb3 |
| Gene Alias | - |
| Gene Description | beta-defensin 3 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK. |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from PBS, pH 7.4. |
| Gene ID | 641623 |
Más información
Rat Defb3 (Q32ZI4) recombinant protein expressed in Escherichia coli.