Defb3 (Rat) Recombinant Protein
  • Defb3 (Rat) Recombinant Protein

Defb3 (Rat) Recombinant Protein

Ref: AB-P8452
20 ug

Información del producto

Defb3 (Rat) Recombinant Protein
Información adicional
Size 20 ug
Gene Name Defb3
Gene Alias -
Gene Description beta-defensin 3
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq KKVYNAVSCMTNGGICWLKCSGTFREIGSCGTRQLKCCKKK.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 641623

Enviar un mensaje


Defb3 (Rat) Recombinant Protein

Defb3 (Rat) Recombinant Protein