Defb1 (Rat) Recombinant Protein
  • Defb1 (Rat) Recombinant Protein

Defb1 (Rat) Recombinant Protein

Ref: AB-P8447
20 ug

Información del producto

Defb1 (Rat) Recombinant Protein
Información adicional
Size 20 ug
Gene Name Defb1
Gene Alias -
Gene Description defensin beta 1
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 83687

Enviar un mensaje


Defb1 (Rat) Recombinant Protein

Defb1 (Rat) Recombinant Protein