DEFB1 (Human) Recombinant Protein
  • DEFB1 (Human) Recombinant Protein

DEFB1 (Human) Recombinant Protein

Ref: AB-P8445
20 ug

Información del producto

DEFB1 (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name DEFB1
Gene Alias BD1|DEFB-1|DEFB101|HBD1|MGC51822
Gene Description defensin, beta 1
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM PBS pH 7.4 and 130mM sodium chloride.
Gene ID 1672

Enviar un mensaje


DEFB1 (Human) Recombinant Protein

DEFB1 (Human) Recombinant Protein