Ver mas grande
ARTN (Human) Recombinant Protein,homodimer
AB-P8444
Producto nuevo
ARTN (Human) Recombinant Protein,homodimer
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | ARTN |
| Gene Alias | ENOVIN|EVN|NBN |
| Gene Description | artemin |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 10mM sodium citrate pH 4.5 and 25mM sodium chloride. |
| Gene ID | 9048 |
Más información
Human ARTN (Q5T4W7) recombinant protein expressed in Escherichia coli.