AREG (Human) Recombinant Protein
  • AREG (Human) Recombinant Protein

AREG (Human) Recombinant Protein

Ref: AB-P8443
AREG (Human) Recombinant Protein

Información del producto

Human AREG (P15514) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name AREG
Gene Alias AR|CRDGF|MGC13647|SDGF
Gene Description amphiregulin
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 374

Enviar un mensaje


AREG (Human) Recombinant Protein

AREG (Human) Recombinant Protein