APOM (Human) Recombinant Protein
  • APOM (Human) Recombinant Protein

APOM (Human) Recombinant Protein

Ref: AB-P8439
APOM (Human) Recombinant Protein

Información del producto

Human APOM (O95445, 23 a.a. - 188 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name APOM
Gene Alias G3a|HSPC336|MGC22400|NG20
Gene Description apolipoprotein M
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl pH-8 1mM DTT and 10% glycerol.
Gene ID 55937

Enviar un mensaje


APOM (Human) Recombinant Protein

APOM (Human) Recombinant Protein