CLU (Dog) Recombinant Protein
  • CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein

Ref: AB-P8437
CLU (Dog) Recombinant Protein

Información del producto

Dog CLU (P25473) recombinant protein with FLAG-tag at N-terminal expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name CLU
Gene Alias GP80
Gene Description clusterin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq PGDYKDDDDKPAGDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRI
Form Lyophilized
Antigen species Target species Dog
Storage Buffer Lyophilized from 20mM Tris buffer and 20mM NaCl, pH 7.5.
Gene ID 442971

Enviar un mensaje


CLU (Dog) Recombinant Protein

CLU (Dog) Recombinant Protein