CLU (Human) Recombinant Protein
  • CLU (Human) Recombinant Protein

CLU (Human) Recombinant Protein

Ref: AB-P8430
CLU (Human) Recombinant Protein

Información del producto

Human CLU (P10909, 1 a.a. - 427 a.a.) partial-length recombinant protein with FLAG-tag at C-terminal expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name CLU
Gene Alias AAG4|APOJ|CLI|KUB1|MGC24903|SGP-2|SGP2|SP-40|TRPM-2|TRPM2
Gene Description clusterin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIRE
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.5
Gene ID 1191

Enviar un mensaje


CLU (Human) Recombinant Protein

CLU (Human) Recombinant Protein