APOD (Human) Recombinant Protein
  • APOD (Human) Recombinant Protein

APOD (Human) Recombinant Protein

Ref: AB-P8425
APOD (Human) Recombinant Protein

Información del producto

Human APOD (P05090,W99H, C116S, I118S, L120S) mutant recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name APOD
Gene Alias -
Gene Description apolipoprotein D
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq FHLGKCPNPPVQENFDVNKYPGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYHILATDYENYALVYSCTSISQSFHVDFAWILARNVALPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSAHHHHHH.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 4mM KH2PO4, 16mM Na2HPO4?and 115mM NaCl pH 7.5
Gene ID 347

Enviar un mensaje


APOD (Human) Recombinant Protein

APOD (Human) Recombinant Protein