APOA1 (Human) Recombinant Protein
  • APOA1 (Human) Recombinant Protein

APOA1 (Human) Recombinant Protein

Ref: AB-P8418
APOA1 (Human) Recombinant Protein

Información del producto

Human APOA1 (P02647, 25-267 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name APOA1
Gene Alias MGC117399
Gene Description apolipoprotein A-I
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALE
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH8.0) and 10% glycerol.
Gene ID 335

Enviar un mensaje


APOA1 (Human) Recombinant Protein

APOA1 (Human) Recombinant Protein