ANGPTL7 (Human) Recombinant Protein
  • ANGPTL7 (Human) Recombinant Protein

ANGPTL7 (Human) Recombinant Protein

Ref: AB-P8415
ANGPTL7 (Human) Recombinant Protein

Información del producto

Human ANGPTL7 (O43827, 27 a.a. - 346 a.a.) partial-length recombinant protein expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name ANGPTL7
Gene Alias AngX|CDT6|RP4-647M16.2|dJ647M16.1
Gene Description angiopoietin-like 7
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNC
Form Liquid
Antigen species Target species Human
Storage Buffer 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID 10218

Enviar un mensaje


ANGPTL7 (Human) Recombinant Protein

ANGPTL7 (Human) Recombinant Protein