Ver mas grande
ANGPTL4 (Human) Recombinant Protein
AB-P8412
Producto nuevo
ANGPTL4 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | ANGPTL4 |
| Gene Alias | ANGPTL2|ARP4|FIAF|HFARP|NL2|PGAR|pp1158 |
| Gene Description | angiopoietin-like 4 |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MRGSHHHHHHGMASHMGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M Acetate buffer pH-4. |
| Gene ID | 51129 |
Más información
Human ANGPTL4 (Q9BY76) recombinant protein with His-tag at N-terminal expressed in Escherichia coli.