ANGPTL3 (Human) Recombinant Protein
  • ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein

Ref: AB-P8411
ANGPTL3 (Human) Recombinant Protein

Información del producto

Human ANGPTL3 (Q9Y5C1, 17 a.a. - 460 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQ
Form Liquid
Antigen species Target species Human
Storage Buffer Buffered Saline (pH 7.4),30% glycerol And 1mM DTT.
Gene ID 27329

Enviar un mensaje


ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein