ANGPTL3 (Human) Recombinant Protein
  • ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein

Ref: AB-P8408
ANGPTL3 (Human) Recombinant Protein

Información del producto

Human ANGPTL3 (Q9Y5C1, 26 a.a. - 233 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASHMSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAP.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.05M Acetate buffer pH-4.
Gene ID 27329

Enviar un mensaje


ANGPTL3 (Human) Recombinant Protein

ANGPTL3 (Human) Recombinant Protein