ANGPT2 (Human) Recombinant Protein
  • ANGPT2 (Human) Recombinant Protein

ANGPT2 (Human) Recombinant Protein

Ref: AB-P8406
ANGPT2 (Human) Recombinant Protein

Información del producto

Human ANGPT2 (O15123, 19 a.a. - 496 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in CHO cell.
Información adicional
Size 2 x 10 ug
Gene Name ANGPT2
Gene Alias AGPT2|ANG2
Gene Description angiopoietin 2
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTV
Form Liquid
Antigen species Target species Human
Storage Buffer Phosphate buffered saline (pH7.4) and 10% glycerol.
Gene ID 285

Enviar un mensaje


ANGPT2 (Human) Recombinant Protein

ANGPT2 (Human) Recombinant Protein