Ver mas grande
ANGPT2 (Human) Recombinant Protein
AB-P8406
Producto nuevo
ANGPT2 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | ANGPT2 |
| Gene Alias | AGPT2|ANG2 |
| Gene Description | angiopoietin 2 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTV |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Phosphate buffered saline (pH7.4) and 10% glycerol. |
| Gene ID | 285 |
Más información
Human ANGPT2 (O15123, 19 a.a. - 496 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in CHO cell.