Ver mas grande
TNFRSF18 (Human) Recombinant Protein
AB-P8404
Producto nuevo
TNFRSF18 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | TNFSF18 |
| Gene Alias | AITRL|GITRL|MGC138237|TL6|hGITRL |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 18 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MASMTGGQQMGRGSHMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea. |
| Gene ID | 8995 |
Más información
Human TNFRSF18 (Q9UNG2, 81 a.a. - 199 a.a) partial-length recombinant protein with T7-tag at N-terminal expressed in Escherichia coli.