Ver mas grande
TNFRSF18 (Human) Recombinant Protein
AB-P8402
Producto nuevo
TNFRSF18 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | TNFSF18 |
| Gene Alias | AITRL|GITRL|MGC138237|TL6|hGITRL |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 18 |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 10mM sodium citrate (pH 3.5), 1mMDTT and 10% glycerol |
| Gene ID | 8995 |
Más información
Human TNFRSF18 (Q9UNG2, 72 a.a. -199 a.a.) partial-length recombinant protein expressed in Escherichia coli.