AIF1L (Human) Recombinant Protein
  • AIF1L (Human) Recombinant Protein

AIF1L (Human) Recombinant Protein

Ref: AB-P8400
AIF1L (Human) Recombinant Protein

Información del producto

Human AIF1L (Q9BQI0, 1 a.a. - 150 a.a.) partial-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name AIF1L
Gene Alias C9orf58|FLJ12783|IBA2|MGC29466
Gene Description allograft inflammatory factor 1-like
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH8.0), 1mM DTT, 0.1mM NaCl and 20% glycerol.
Gene ID 83543

Enviar un mensaje


AIF1L (Human) Recombinant Protein

AIF1L (Human) Recombinant Protein