ADIPOQ (Human) Recombinant Protein, Globular
  • ADIPOQ (Human) Recombinant Protein, Globular

ADIPOQ (Human) Recombinant Protein, Globular

Ref: AB-P8396
ADIPOQ (Human) Recombinant Protein, Globular

Información del producto

Human ADIPOQ (Q15848) recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name ADIPOQ
Gene Alias ACDC|ACRP30|ADPN|APM-1|APM1|GBP28|adiponectin
Gene Description adiponectin, C1Q and collagen domain containing
Storage Conditions For long term, store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10mM sodium phosphate & 0.5mM DTT, pH 7.5.
Gene ID 9370

Enviar un mensaje


ADIPOQ (Human) Recombinant Protein, Globular

ADIPOQ (Human) Recombinant Protein, Globular